PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G62320.1
Common NameATMYB99, ATMYBCU15, MYB99
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 245aa    MW: 27355.8 Da    PI: 4.9387
Description myb domain protein 99
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G62320.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.8e-131569148
                     TSSS-HHHHHHHHHHHHHTTTT.......-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.......tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +lvd  +  G+        +W+ +++  g++R++k+c++rw +yl
      AT5G62320.1 15 KGPWTVEEDGKLVDFLRARGNCggggggwCWRDVPKLAGLRRCGKSCRLRWTNYL 69
                     79***************************************************97 PP

2Myb_DNA-binding55.21.6e-1775119147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+eE +l +d++++lG++ W++Ia +++ gRt++++k++w+++
      AT5G62320.1  75 RGLFTEEEIQLVIDLHARLGNR-WSKIAVELP-GRTDNDIKNYWNTH 119
                      788*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-18672IPR009057Homeodomain-like
PROSITE profilePS5129410.8861069IPR017930Myb domain
SuperFamilySSF466892.13E-2312116IPR009057Homeodomain-like
SMARTSM007171.0E-41471IPR001005SANT/Myb domain
PfamPF002491.7E-111569IPR001005SANT/Myb domain
CDDcd001679.06E-41769No hitNo description
PROSITE profilePS5129426.18670124IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2573125IPR009057Homeodomain-like
SMARTSM007179.8E-1774122IPR001005SANT/Myb domain
PfamPF002491.0E-1575119IPR001005SANT/Myb domain
CDDcd001675.50E-1278120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000036anatomyleaf vascular system
PO:0000056anatomyflower bud
PO:0005660anatomyhydathode
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009071anatomyanther wall tapetum
PO:0025022anatomycollective leaf structure
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGGRKPCCDE VGLRKGPWTV EEDGKLVDFL RARGNCGGGG GGWCWRDVPK LAGLRRCGKS  60
CRLRWTNYLR PDLKRGLFTE EEIQLVIDLH ARLGNRWSKI AVELPGRTDN DIKNYWNTHI  120
KRKLIRMGID PNTHRRFDQQ KVNEEETILV NDPKPLSETE VSVALKNDTS AVLSGNLNQL  180
ADVDGDDQPW SFLMENDEGG GGDAAGELTM LLSGDITSSC SSSSSLWMKY GEFGYEDLEL  240
GCFDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261312425128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247451_at0.0
Expression AtlasAT5G62320-
AtGenExpressAT5G62320-
ATTED-IIAT5G62320-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB99).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00577DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G62320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDBrassinosteroid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G62320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1990260.0AF199026.2 Arabidopsis thaliana putative transcription factor (MYB99) mRNA, complete cds.
GenBankAY5196440.0AY519644.1 Arabidopsis thaliana MYB transcription factor (At5g62320) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201038.10.0myb domain protein 99
SwissprotQ50EX61e-67ODO1_PETHY; Protein ODORANT1
TrEMBLA0MFR30.0A0MFR3_ARATH; Putative uncharacterized protein (Fragment)
TrEMBLQ9SNW90.0Q9SNW9_ARATH; MYB transcription factor
STRINGAT5G62320.11e-180(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Alves-Ferreira M, et al.
    Global expression profiling applied to the analysis of Arabidopsis stamen development.
    Plant Physiol., 2007. 145(3): p. 747-62
    [PMID:17905860]
  5. Yang C,Vizcay-Barrena G,Conner K,Wilson ZA
    MALE STERILITY1 is required for tapetal development and pollen wall biosynthesis.
    Plant Cell, 2007. 19(11): p. 3530-48
    [PMID:18032629]
  6. Ito T, et al.
    Arabidopsis MALE STERILITY1 encodes a PHD-type transcription factor and regulates pollen and tapetum development.
    Plant Cell, 2007. 19(11): p. 3549-62
    [PMID:18032630]
  7. Grini PE, et al.
    The ASH1 HOMOLOG 2 (ASHH2) histone H3 methyltransferase is required for ovule and anther development in Arabidopsis.
    PLoS ONE, 2009. 4(11): p. e7817
    [PMID:19915673]
  8. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]